CALCISEPTINE
Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac contraction inhibitor. Neurotoxic. Active in vivo and in vitro.
SPECIFICATION OF CALCISEPTINE
Product Name: Calciseptine (Calciseptine, L-type Ca2+ channel blocker)
CAS N0.:
Sequence: MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK (Modifications: Disulfide bonds: 4-23, 18-40, 42-53, 54-59)
Purity: > 98%(HPLC)
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 7167.40
Molecular formula: C304H477N91O88S11
Source: Chemical synthesis
Shipping and storage: Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF CALCISEPTINE
Calciseptineis a natural peptide consisting of 60 amino acids with four disulfide bonds. The peptide is a Ca2+ channel blocker, has agonist actions on L-type Ca2+ currents of frog and mammalian skeletal muscle.
KS-V Peptide provides one-stop services for drug R&D. Leveraging the technical advantages in the field of Structure-Based Drug Discovery (SBDD) and Chemistry（Medicinal Chemistry and Peptide Synthesis), KS-V Peptide provides leading CRO drug discovery services and CMC services to global biopharmaceutical clients. Apart from this, KS-V Peptide also provides high-end biological reagents and raw materials and difficult peptides, such as Post-translational Histones and Nucleosome Assembly, Ubiquitins and Ubiquitin Probes, Toxins and Analogues, modification and optimization of pharmaceutical peptide and development of professional peptidetechnology for pharma, biotechs, and universities around the world. More information about our peptide chemical structure identification, contact us.
Send product request
Other supplier products
 |
SPECIFICATION OF MAMBALGIN 1 | CAT O1010-V CAS NO. Product Name Mambalgin1 Purity > 98% Form/State Lyophi... |
 |
SPECIFICATION OF IBERIOTOXIN | CAT K1060-V CAS NO. Product Name Iberiotoxin Purity > 98% Form/State Lyoph... |
 |
H3K4me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
L CARNOSINE | LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i... |
 |
PLECANATIDE | Plecanatideis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation ... |
Same products
 |
Easy-cleaning Silicone-Modified Waterborne UV Resin | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | LUV533 is a high-performance, silicone-modified hexafunctional waterborne UV resinengineered to d... |
 |
Water-based Soft-Touch Resin for Consumer Electronics | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | Water-based Soft-Touch Resinis an advanced coating material formulated to deliver a luxurious, ve... |
 |
Conformal Coatings | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | The conformal coatingsprovide good adhesion to metal, PCB and other substrates after curing at ro... |
 |
Metalized & Laser Transfer coating | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | Metallized and laser transfer coatingsare designed with sustainability in mind, ensuring minimal ... |
 |
Hydrophilic coatings for Air Conditioner | Seller: Guangzhou Human New Material Science and Technology Co., Ltd | A water-based coating combination applied on the surface of aluminum foil, which forms a layer wi... |
