CALCISEPTINE
Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac contraction inhibitor. Neurotoxic. Active in vivo and in vitro.
SPECIFICATION OF CALCISEPTINE
Product Name: Calciseptine (Calciseptine, L-type Ca2+ channel blocker)
CAS N0.:
Sequence: MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK (Modifications: Disulfide bonds: 4-23, 18-40, 42-53, 54-59)
Purity: > 98%(HPLC)
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 7167.40
Molecular formula: C304H477N91O88S11
Source: Chemical synthesis
Shipping and storage: Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF CALCISEPTINE
Calciseptineis a natural peptide consisting of 60 amino acids with four disulfide bonds. The peptide is a Ca2+ channel blocker, has agonist actions on L-type Ca2+ currents of frog and mammalian skeletal muscle.
KS-V Peptide provides one-stop services for drug R&D. Leveraging the technical advantages in the field of Structure-Based Drug Discovery (SBDD) and Chemistry（Medicinal Chemistry and Peptide Synthesis), KS-V Peptide provides leading CRO drug discovery services and CMC services to global biopharmaceutical clients. Apart from this, KS-V Peptide also provides high-end biological reagents and raw materials and difficult peptides, such as Post-translational Histones and Nucleosome Assembly, Ubiquitins and Ubiquitin Probes, Toxins and Analogues, modification and optimization of pharmaceutical peptide and development of professional peptidetechnology for pharma, biotechs, and universities around the world. More information about our peptide chemical structure identification, contact us.
Send product request
Other supplier products
 |
Ω AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVA is an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyn... |
 |
KURTOXIN | SPECIFICATION OF KURTOXIN CAT C1090-V CAS NO. Product Name kurtoxin Purity > 98% ... |
 |
PLTX II | SNX482 Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective, irreversible presynaptic voltage-gate... |
 |
H3K4me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
ACETYL OCTAPEPTIDE 3/1(SNAP-8) | Acetyl octapeptide 31(SNAP-8) Reducing the depth of wrinkles caused by contraction of facial expression muscles, especially a safer, cheaper, mild... |
Same products
 |
KLUBER PETAMO GHY 133 N Grease for Placement Machine | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | NSK LR3 80G/PC 20PC,50PC/Carton NSK AS2 80G/PC 20PC,50PC/Carton ... |
 |
DL-Mevalonolactone CAS 674-26-0 Wholesale & Bulk | Seller: Wuhan Fortuna Chemical Co.,Ltd. | DL-Mevalonolactone CAS 674-26-0Wholesale & Bulk DL-Mevalonolactone is a chemical compound, s... |
 |
Cyclophosphamide CAS 50-18-0 Wholesale & Bulk | Seller: Wuhan Fortuna Chemical Co.,Ltd. | Cyclophosphamide CAS 50-18-0Wholesale & Bulk Cyclophosphamide is a medication used primarily... |
 |
Dydrogesterone CAS 152-62-5 Wholesale & Bulk | Seller: Wuhan Fortuna Chemical Co.,Ltd. | Dydrogesterone CAS 152-62-5Wholesale & Bulk Dydrogesterone is a synthetic progestogen, a typ... |
 |
Acriflavine Hydrochloride CAS 8063-24-9 Wholesale & Bulk | Seller: Wuhan Fortuna Chemical Co.,Ltd. | Acriflavine Hydrochloride CAS 8063-24-9Wholesale & Bulk Acriflavine hydrochloride is a chemi... |
