CALCISEPTINE
Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac contraction inhibitor. Neurotoxic. Active in vivo and in vitro.
SPECIFICATION OF CALCISEPTINE
Product Name: Calciseptine (Calciseptine, L-type Ca2+ channel blocker)
CAS N0.:
Sequence: MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK (Modifications: Disulfide bonds: 4-23, 18-40, 42-53, 54-59)
Purity: > 98%(HPLC)
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 7167.40
Molecular formula: C304H477N91O88S11
Source: Chemical synthesis
Shipping and storage: Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF CALCISEPTINE
Calciseptineis a natural peptide consisting of 60 amino acids with four disulfide bonds. The peptide is a Ca2+ channel blocker, has agonist actions on L-type Ca2+ currents of frog and mammalian skeletal muscle.
KS-V Peptide provides one-stop services for drug R&D. Leveraging the technical advantages in the field of Structure-Based Drug Discovery (SBDD) and Chemistry（Medicinal Chemistry and Peptide Synthesis), KS-V Peptide provides leading CRO drug discovery services and CMC services to global biopharmaceutical clients. Apart from this, KS-V Peptide also provides high-end biological reagents and raw materials and difficult peptides, such as Post-translational Histones and Nucleosome Assembly, Ubiquitins and Ubiquitin Probes, Toxins and Analogues, modification and optimization of pharmaceutical peptide and development of professional peptidetechnology for pharma, biotechs, and universities around the world. More information about our peptide chemical structure identification, contact us.
Send product request
Other supplier products
 |
PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger cu peptidefor collagen renewal. SPECIFICATION OF PALMITOY... |
 |
PLECANATIDE | Polypeptidesis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation... |
 |
AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna... |
 |
H3K4ME1 | Synthesized histone H3peptide corresponding to residues within 1-135 of human histone H3 with monomethylation K4 modification. SPECIFICATION OF ... |
 |
PLTX II | SNX482 Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective, irreversible presynaptic voltage-gate... |
Same products
 |
Mobil DTE 832 ISO VG 32 208L Combined Cycle Turbine Oils | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | Mobil DTE832and 846 aresuperior performance turbine oilsdesigned for use in steam turbines, gas t... |
 |
MOBILUX EP 0 16KG Lithium Complex Grease | Seller: Guangdong Juguangheng Automation Equipment Co.,Ltd. | These lithium hydroxystearate greases are formulated to provide extra protection against wear, ru... |
 |
Nisin Direct supply | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | Nisin, a natural antimicrobial peptide, has various applications in the food industry due to its ... |
 |
Large supply Nisin | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | Nisin is considered a natural preservative because it is derived from the fermentation of bacteri... |
 |
Nisin Wholesale Price | Seller: Hebei Shengxue Dacheng Pharmaceutical Co., Ltd. | Nisin is a natural antimicrobial peptide produced by certain strains of the bacterium Lactococcus... |
