CALCISEPTINE
Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac contraction inhibitor. Neurotoxic. Active in vivo and in vitro.
SPECIFICATION OF CALCISEPTINE
Product Name: Calciseptine (Calciseptine, L-type Ca2+ channel blocker)
CAS N0.:
Sequence: MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK (Modifications: Disulfide bonds: 4-23, 18-40, 42-53, 54-59)
Purity: > 98%(HPLC)
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 7167.40
Molecular formula: C304H477N91O88S11
Source: Chemical synthesis
Shipping and storage: Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
APPLICATION OF CALCISEPTINE
Calciseptineis a natural peptide consisting of 60 amino acids with four disulfide bonds. The peptide is a Ca2+ channel blocker, has agonist actions on L-type Ca2+ currents of frog and mammalian skeletal muscle.
KS-V Peptide provides one-stop services for drug R&D. Leveraging the technical advantages in the field of Structure-Based Drug Discovery (SBDD) and Chemistry（Medicinal Chemistry and Peptide Synthesis), KS-V Peptide provides leading CRO drug discovery services and CMC services to global biopharmaceutical clients. Apart from this, KS-V Peptide also provides high-end biological reagents and raw materials and difficult peptides, such as Post-translational Histones and Nucleosome Assembly, Ubiquitins and Ubiquitin Probes, Toxins and Analogues, modification and optimization of pharmaceutical peptide and development of professional peptidetechnology for pharma, biotechs, and universities around the world. More information about our peptide chemical structure identification, contact us.
在线联系供应商
Other supplier products
 |
H3K36me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
H3K4me2 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
PROTOXIN II | NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2... |
 |
H3S10PH | Synthesized histone H3 peptide corresponding to residues within 1-135 of human histone H3 with phosphorylation S10 modification. SPECIFICATION O... |
 |
ACETYL TETRAPEPTIDE 5(EYESERYL) | Especially suitable for eye products, eliminating bags and dark circles, improving skin elasticity and smoothness. SPECIFICATION OF ACETYL TETRAPE... |
Same products
 |
Sucralose powder Food additive | 卖方: Shanghai Yifu Food Ingredients Co., Ltd | Sucralose, as a new generation of high-sweetness sweetener, has demonstrated comprehensive and ou... |
 |
Sucralose Purchase price | 卖方: Shanghai Yifu Food Ingredients Co., Ltd | Sucralose, as a high-sweetness, calorie-free, and highly stable artificial sweetener, enjoys wide... |
 |
Sucralose Partners, long-termCooperation | 卖方: Shanghai Yifu Food Ingredients Co., Ltd | Sucralose is currently a widely used high-potency sweetener globally. Its safety has been verifie... |
 |
Sucralose | 卖方: Shanghai Yifu Food Ingredients Co., Ltd | Sucralose is a high-sweetness agent obtained by replacing the hydroxyl groups at positions 4, 1',... |
 |
Sucralose | 卖方: Shanghai Yifu Food Ingredients Co., Ltd | Sucralose is a trichloro derivative of sucrose (4,1',6'-trichloro-4,1',6'-dideoxy-galactosucrose)... |
