SPECIFICATION OF IBERIOTOXIN
|
CAT |
K1060-V |
|
CAS NO. |
|
|
Product Name |
Iberiotoxin |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C179H276N50O56S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. |
|
Storage of solutions |
Up to two weeks at 4C or three months at -20C. |
|
Sequence |
ZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. Z = Pyrrolidone carboxylic acid) |
APPLICATION OF IBERIOTOXIN
Iberiotoxin (IbTX) is a remarkably selective alpha-K toxin peptide (alpha-KTx) inhibitor of the maxi-K channel.
As one of peptide manufacturing companies, we will produce more high quality products for customers, if you have needs, please contact us.
If you want to know more about synthetic route, please visit our website.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
UB AMC | UbiquitinAMCis prepared by the C-terminal derivatization of ubiquitin with 7-amino-4-methylcoumarin. SPECIFICATION OF UB AMC CAT U... |
 |
CALCISEPTINE | Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardiac ... |
 |
H3K36me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
PROFESSIONAL PEPTIDE SUPPLIER | PEPTIDE TOXIN Toxic peptidesAnd Analogues Peptides are mostly extracted from toxic animal venom glands, such as spiders, snakes, scorpions, and so... |
 |
KALIOTOXIN | The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also ... |
Похожие товары
 |
rPET Monofilament Fiber - EM Series | Продавец: San Fang Chemical Industry Co., Ltd. | ROFIOS® rPET-Monofilament fiber San Fang is a recycled yarn manufacturer who has concentrate... |
|
|
SPECIFICATION OF IBERIOTOXIN | Продавец: Hefei KS-V Peptide Biological Technology Co., Ltd. | CAT K1060-V CAS NO. Product Name Iberiotoxin P... |
