SPECIFICATION OF IBERIOTOXIN
|
CAT |
K1060-V |
|
CAS NO. |
|
|
Product Name |
Iberiotoxin |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C179H276N50O56S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. |
|
Storage of solutions |
Up to two weeks at 4C or three months at -20C. |
|
Sequence |
ZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. Z = Pyrrolidone carboxylic acid) |
APPLICATION OF IBERIOTOXIN
Iberiotoxin (IbTX) is a remarkably selective alpha-K toxin peptide (alpha-KTx) inhibitor of the maxi-K channel.
As one of peptide manufacturing companies, we will produce more high quality products for customers, if you have needs, please contact us.
If you want to know more about synthetic route, please visit our website.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
 |
PLTX II | SNX482 Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective, irreversible presynaptic voltage-gate... |
 |
APETX2 | ASIC3 channels, APETx2inhibits ASIC3 channels1 SPECIFICATION OF APETX2 CAT O1040-V CAS NO. Product Name ... |
 |
AGATOXIN IVA | P-type Ca2+ channels. ω-Agatoxin IVAis an antagonist of voltage-sensitive P-type Ca2+ channels1. It blocks neuromuscular transmission presyna... |
 |
L CARNOSINE | LCarnosineis a dipeptide (sequence: beta-Ala-His) and a well-documented water-borne antioxidant with wound healing activity, and naturally occurs i... |
 |
SPECIFICATION OF MAMBALGIN 1 | CAT O1010-V CAS NO. Product Name Mambalgin1 Purity > 98% Form/State Lyophi... |
Похожие товары
 |
rPET Monofilament Fiber - EM Series | Продавец: San Fang Chemical Industry Co., Ltd. | ROFIOS® rPET-Monofilament fiber San Fang is a recycled yarn manufacturer who has concentrate... |
|
|
SPECIFICATION OF IBERIOTOXIN | Продавец: Hefei KS-V Peptide Biological Technology Co., Ltd. | CAT K1060-V CAS NO. Product Name Iberiotoxin P... |
