SPECIFICATION OF IBERIOTOXIN
|
CAT |
K1060-V |
|
CAS NO. |
|
|
Product Name |
Iberiotoxin |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C179H276N50O56S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. |
|
Storage of solutions |
Up to two weeks at 4C or three months at -20C. |
|
Sequence |
ZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. Z = Pyrrolidone carboxylic acid) |
APPLICATION OF IBERIOTOXIN
Iberiotoxin (IbTX) is a remarkably selective alpha-K toxin peptide (alpha-KTx) inhibitor of the maxi-K channel.
As one of peptide manufacturing companies, we will produce more high quality products for customers, if you have needs, please contact us.
If you want to know more about synthetic route, please visit our website.
Send product request
Other supplier products
 |
H3K9me1 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... |
 |
KALIOTOXIN | The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also ... |
 |
APETX2 | ASIC3 channels, APETx2inhibits ASIC3 channels1 SPECIFICATION OF APETX2 CAT O1040-V CAS NO. Product Name ... |
 |
PLTX II | SNX482 Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective, irreversible presynaptic voltage-gate... |
 |
CALCICLUDINE | L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1. SPECIFICATION OF CALCICLUDINE Product Nam... |
Same products
 |
rPET Monofilament Fiber - EM Series | Seller: San Fang Chemical Industry Co., Ltd. | ROFIOS® rPET-Monofilament fiber San Fang is a recycled yarn manufacturer who has concentrate... |
|
|
SPECIFICATION OF IBERIOTOXIN | Seller: Hefei KS-V Peptide Biological Technology Co., Ltd. | CAT K1060-V CAS NO. Product Name Iberiotoxin P... |
