SHK TOXIN
Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold higher concentration than that required to inhibit KV1.3 channels.
SPECIFICATION OF SHK TOXIN
|
CAT |
K1010-V |
|
CAS NO. |
|
|
Product Name |
ShK Toxin |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
4055 Da |
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds between Cys3-Cys35, Cys12-Cys28, and Cys17-Cys32) |
APPLICATION OF SHK TOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.
Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged peptide manufacturers and custom peptide librarysuppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biological technologycompanies, and scientific research institute.
Отправить запрос, связаться с поставщиком
Другие товары поставщика
| ACETYL HEXAPEPTIDE 3(ARGIRELINE) | The peptide reduces wrinkle development due to unconscious skin movement. Botulinum toxin A acts as a protease, cutting the protein SNAP-25 from th... | |
| PALMITOYL TRIPEPTIDE 1(PAL GHK) | Palmitoyl tripeptide-1, also known as pal-GHK and palmitoyl oligopeptide, is a messenger cu peptidefor collagen renewal. SPECIFICATION OF PALMITOY... | |
| H3K4me3 | As one of the professional custom peptide synthesis companiesin China, KS-V Peptide has been specialized in providing customized peptides synthesis... | |
| SPECIFICATION OF MAMBALGIN 1 | CAT O1010-V CAS NO. Product Name Mambalgin1 Purity > 98% Form/State Lyophi... | |
| PALMITOYL PENTAPEPTIDE 4 | Palmitoyl pentapeptide-4 (Matrixyl®) is a small, highly specific bioactive peptide that is reported to stimulate the production of elastin, fib... |
Похожие товары
| UB AMC | Продавец: Hefei KS-V Peptide Biological Technology Co., Ltd. | UbiquitinAMCis prepared by the C-terminal derivatization of ubiquitin with 7-amino-4-methylcoumar... | |
| SYN AKE | Продавец: Hefei KS-V Peptide Biological Technology Co., Ltd. | Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimi... | |
| SHK TOXIN | Продавец: Hefei KS-V Peptide Biological Technology Co., Ltd. | Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar ... | |
| SEMAGLUTIDE AND IMPURITY | Продавец: Hefei KS-V Peptide Biological Technology Co., Ltd. | Semaglutide Peptide for Sale "Natural semaglutideis a recombinant DNA produced polypeptide ana... | |
| PSALMOTOXIN 1 | Продавец: Hefei KS-V Peptide Biological Technology Co., Ltd. | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (AS... |















