PROTOXIN II
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.
SPECIFICATION OF PROTOXIN II
|
CAT |
N1030-V |
|
CAS NO. |
|
|
Product Name |
ProtoxinII |
|
Purity |
> 98% |
|
Form/State |
Lyophilized powder |
|
Solubility |
Soluble in water |
|
Molecular weight |
|
|
Molecular formula |
C169H274N54O48S7 |
|
Source |
Synthetic peptide |
|
Storage |
Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. |
|
Storage of solutions |
Up to two weeks at 4°C or three months at -20°C. |
|
Sequence |
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32) |
APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.
As one of peptide synthesis companies, we can offer kinds of related products for sale, anything you need, please leave us a message.
More kinds of peptide service, please visit our website.
Send product request
Other supplier products
 |
CALCICLUDINE | L-type Ca2+ channels. Calcicludineis a potent and specific antagonist of neuronal L-type CaV channels1. SPECIFICATION OF CALCICLUDINE Product Nam... |
 |
PROFESSIONAL PEPTIDE SUPPLIER | PEPTIDE TOXIN Toxic peptidesAnd Analogues Peptides are mostly extracted from toxic animal venom glands, such as spiders, snakes, scorpions, and so... |
 |
Ω AGATOXIN IVB | P-type and Q-type Ca2+ channels, ω-AgatoxinTK is an antagonist of voltage-sensitive P-type Ca2+ channels1 SPECIFICATION OF Ω AGATOXI... |
 |
PLECANATIDE | Plecanatideis a minimally absorbed agonist of guanylate cyclase C receptors in the intestine and is used for the treatment of chronic constipation ... |
 |
TYPES OF PEPTIDES FOR SALE | Types of Peptide Wholesale Relying on the University of Science and Technology of China and Tsinghua University, Hefei KS-V Peptide Biotechnology ... |
Same products
 |
UB AMC | Seller: Hefei KS-V Peptide Biological Technology Co., Ltd. | UbiquitinAMCis prepared by the C-terminal derivatization of ubiquitin with 7-amino-4-methylcoumar... |
 |
SYN AKE | Seller: Hefei KS-V Peptide Biological Technology Co., Ltd. | Tripeptide-3, also known as dipeptide diaminobutyryl benzyl amide diacetate or SYN®-AKE, mimi... |
 |
SHK TOXIN | Seller: Hefei KS-V Peptide Biological Technology Co., Ltd. | Various KV K+ channels. Stichodactyla Toxinblocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar ... |
 |
SEMAGLUTIDE AND IMPURITY | Seller: Hefei KS-V Peptide Biological Technology Co., Ltd. | Semaglutide Peptide for Sale "Natural semaglutideis a recombinant DNA produced polypeptide ana... |
 |
PSALMOTOXIN 1 | Seller: Hefei KS-V Peptide Biological Technology Co., Ltd. | ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (AS... |
